NSEP1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2135096
Artikelname: NSEP1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2135096
Hersteller Artikelnummer: orb2135096
Alternativnummer: BYT-ORB2135096-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NSEP1
Konjugation: Biotin
Alternative Synonym: YB1, BP-8, CSDB, DBPB, YB-1, CBF-A, CSDA2, EFI-A, NSEP1, NSEP-1, MDR-NF1
NSEP1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 36kDa
NCBI: 004550
UniProt: Q5FVF0
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: NMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNF