NSEP1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2135096
Article Name: NSEP1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2135096
Supplier Catalog Number: orb2135096
Alternative Catalog Number: BYT-ORB2135096-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NSEP1
Conjugation: Biotin
Alternative Names: YB1, BP-8, CSDB, DBPB, YB-1, CBF-A, CSDA2, EFI-A, NSEP1, NSEP-1, MDR-NF1
NSEP1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 36kDa
NCBI: 004550
UniProt: Q5FVF0
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: NMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNF