KIF19 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2135771
Artikelname: KIF19 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2135771
Hersteller Artikelnummer: orb2135771
Alternativnummer: BYT-ORB2135771-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human KIF19
Konjugation: Biotin
Alternative Synonym: KIF19A
KIF19 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 55kDa
NCBI: 694941
UniProt: Q2TAC6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: QQLMVALRVRPISVAELEEGATLIAHKVDEQMVVLMDPMEDPDDILRAHR