KIF19 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2135771
Article Name: KIF19 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2135771
Supplier Catalog Number: orb2135771
Alternative Catalog Number: BYT-ORB2135771-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human KIF19
Conjugation: Biotin
Alternative Names: KIF19A
KIF19 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 55kDa
NCBI: 694941
UniProt: Q2TAC6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: QQLMVALRVRPISVAELEEGATLIAHKVDEQMVVLMDPMEDPDDILRAHR