CLDN4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2136263
Artikelname: CLDN4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2136263
Hersteller Artikelnummer: orb2136263
Alternativnummer: BYT-ORB2136263-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CLDN4
Konjugation: Biotin
Alternative Synonym: CPER, CPE-R, CPETR, CPETR1, WBSCR8, hCPE-R
CLDN4 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 22kDa
NCBI: 001296
UniProt: O14493
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAAS