CLDN4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2136263
Article Name: CLDN4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2136263
Supplier Catalog Number: orb2136263
Alternative Catalog Number: BYT-ORB2136263-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CLDN4
Conjugation: Biotin
Alternative Names: CPER, CPE-R, CPETR, CPETR1, WBSCR8, hCPE-R
CLDN4 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 22kDa
NCBI: 001296
UniProt: O14493
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: KREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAAS