FLJ23436 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2136353
Artikelname: FLJ23436 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2136353
Hersteller Artikelnummer: orb2136353
Alternativnummer: BYT-ORB2136353-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FLJ23436
Konjugation: Biotin
FLJ23436 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 58kDa
NCBI: 078947
UniProt: Q9H5H4
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: EPESPGFESRSPGLVPPSPEFAPRSPESDSQSPEFESQSPRYEPQSPGYE