FLJ23436 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2136353
Article Name: FLJ23436 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2136353
Supplier Catalog Number: orb2136353
Alternative Catalog Number: BYT-ORB2136353-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FLJ23436
Conjugation: Biotin
FLJ23436 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 58kDa
NCBI: 078947
UniProt: Q9H5H4
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: EPESPGFESRSPGLVPPSPEFAPRSPESDSQSPEFESQSPRYEPQSPGYE