IVNS1ABP Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2137813
| Artikelname: |
IVNS1ABP Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2137813 |
| Hersteller Artikelnummer: |
orb2137813 |
| Alternativnummer: |
BYT-ORB2137813-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human IVNS1ABP |
| Konjugation: |
Biotin |
| Alternative Synonym: |
ND1, ARA3, NS-1, IMD70, NS1BP, FLARA3, KLHL39, NS1-BP, HSPC068 |
| IVNS1ABP Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
72kDa |
| NCBI: |
006460 |
| UniProt: |
Q9Y6Y0 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: RAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLK |
