IVNS1ABP Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2137813
| Article Name: |
IVNS1ABP Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2137813 |
| Supplier Catalog Number: |
orb2137813 |
| Alternative Catalog Number: |
BYT-ORB2137813-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human IVNS1ABP |
| Conjugation: |
Biotin |
| Alternative Names: |
ND1, ARA3, NS-1, IMD70, NS1BP, FLARA3, KLHL39, NS1-BP, HSPC068 |
| IVNS1ABP Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
72kDa |
| NCBI: |
006460 |
| UniProt: |
Q9Y6Y0 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: RAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLK |
