TRIT1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2138447
Artikelname: TRIT1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2138447
Hersteller Artikelnummer: orb2138447
Alternativnummer: BYT-ORB2138447-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRIT1
Konjugation: Biotin
Alternative Synonym: IPT, GRO1, IPPT, MOD5, hGRO1, IPTase, COXPD35
TRIT1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 51kDa
NCBI: 060116
UniProt: Q9H3H1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: PHDKRKVARSLQVFEETGISHSEFLHRQHTEEGGGPLGGPLKFSNPCILW