TRIT1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2138447
Article Name: TRIT1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2138447
Supplier Catalog Number: orb2138447
Alternative Catalog Number: BYT-ORB2138447-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRIT1
Conjugation: Biotin
Alternative Names: IPT, GRO1, IPPT, MOD5, hGRO1, IPTase, COXPD35
TRIT1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 51kDa
NCBI: 060116
UniProt: Q9H3H1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: PHDKRKVARSLQVFEETGISHSEFLHRQHTEEGGGPLGGPLKFSNPCILW