ARID3A Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2138491
Artikelname: ARID3A Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2138491
Hersteller Artikelnummer: orb2138491
Alternativnummer: BYT-ORB2138491-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARID3A
Konjugation: HRP
Alternative Synonym: DRIL1, DRIL3, BRIGHT, E2FBP1
ARID3A Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 63kDa
NCBI: 005215
UniProt: Q99856
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: QAAIDSNRREGRRQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNG