ARID3A Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2138491
Article Name: ARID3A Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2138491
Supplier Catalog Number: orb2138491
Alternative Catalog Number: BYT-ORB2138491-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARID3A
Conjugation: HRP
Alternative Names: DRIL1, DRIL3, BRIGHT, E2FBP1
ARID3A Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 63kDa
NCBI: 005215
UniProt: Q99856
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: QAAIDSNRREGRRQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNG