NOCT Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2139755
Artikelname: NOCT Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2139755
Hersteller Artikelnummer: orb2139755
Alternativnummer: BYT-ORB2139755-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CCRN4L
Konjugation: FITC
Alternative Synonym: NOC, CCR4L, Ccr4c, CCRN4L
NOCT Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 48kDa
NCBI: 036250
UniProt: Q9UK39
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LNSSAASQHPEYLVSPDPEHLEPIDPKELLEECRAVLHTRPPRFQRDFVD