NOCT Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2139755
Article Name: NOCT Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2139755
Supplier Catalog Number: orb2139755
Alternative Catalog Number: BYT-ORB2139755-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CCRN4L
Conjugation: FITC
Alternative Names: NOC, CCR4L, Ccr4c, CCRN4L
NOCT Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 48kDa
NCBI: 036250
UniProt: Q9UK39
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LNSSAASQHPEYLVSPDPEHLEPIDPKELLEECRAVLHTRPPRFQRDFVD