PTF1A Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2139779
Artikelname: PTF1A Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2139779
Hersteller Artikelnummer: orb2139779
Alternativnummer: BYT-ORB2139779-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PTF1A
Konjugation: HRP
Alternative Synonym: p48, PACA, PAGEN2, bHLHa29, PTF1-p48
PTF1A Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 35kDa
NCBI: 835455
UniProt: Q7RTS3
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: PLEDGDELLADEQAEVEFLSHQLHEYCYRDGACLLLQPAPPAAPLALAPP