PTF1A Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2139779
Article Name: PTF1A Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2139779
Supplier Catalog Number: orb2139779
Alternative Catalog Number: BYT-ORB2139779-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PTF1A
Conjugation: HRP
Alternative Names: p48, PACA, PAGEN2, bHLHa29, PTF1-p48
PTF1A Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 35kDa
NCBI: 835455
UniProt: Q7RTS3
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: PLEDGDELLADEQAEVEFLSHQLHEYCYRDGACLLLQPAPPAAPLALAPP