EHMT2 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2139915
Artikelname: EHMT2 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2139915
Hersteller Artikelnummer: orb2139915
Alternativnummer: BYT-ORB2139915-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ChIP, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EHMT2
Konjugation: FITC
Alternative Synonym: G9A, BAT8, GAT8, NG36, KMT1C, C6orf30
EHMT2 Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 132kDa
NCBI: 006700
UniProt: Q96KQ7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VQSLAMRLLSMPGAQGAAAAGSEPPPATTSPEGQPKVHRARKTMSKPGNG