EHMT2 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Catalog Number:
BYT-ORB2139915
| Article Name: |
EHMT2 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2139915 |
| Supplier Catalog Number: |
orb2139915 |
| Alternative Catalog Number: |
BYT-ORB2139915-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
ChIP, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human EHMT2 |
| Conjugation: |
FITC |
| Alternative Names: |
G9A, BAT8, GAT8, NG36, KMT1C, C6orf30 |
| EHMT2 Rabbit Polyclonal Antibody (FITC) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
132kDa |
| NCBI: |
006700 |
| UniProt: |
Q96KQ7 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: VQSLAMRLLSMPGAQGAAAAGSEPPPATTSPEGQPKVHRARKTMSKPGNG |