HTATIP Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2139926
Artikelname: HTATIP Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2139926
Hersteller Artikelnummer: orb2139926
Alternativnummer: BYT-ORB2139926-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HTATIP
Konjugation: HRP
Alternative Synonym: TIP, ESA1, PLIP, TIP60, cPLA2, HTATIP, ZC2HC5, HTATIP1, NEDFASB
HTATIP Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 62kDa
NCBI: 874369
UniProt: C9JL99
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: EAKTPTKNGLPGSRPGSPEREVPASAQASGKTLPIPVQITLRFNLPKERE