HTATIP Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2139926
Article Name: HTATIP Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2139926
Supplier Catalog Number: orb2139926
Alternative Catalog Number: BYT-ORB2139926-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HTATIP
Conjugation: HRP
Alternative Names: TIP, ESA1, PLIP, TIP60, cPLA2, HTATIP, ZC2HC5, HTATIP1, NEDFASB
HTATIP Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 62kDa
NCBI: 874369
UniProt: C9JL99
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: EAKTPTKNGLPGSRPGSPEREVPASAQASGKTLPIPVQITLRFNLPKERE