ZNFN1A2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2142620
Artikelname: ZNFN1A2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2142620
Hersteller Artikelnummer: orb2142620
Alternativnummer: BYT-ORB2142620-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ZNFN1A2
Konjugation: Biotin
Alternative Synonym: ANF1A2, HELIOS, ZNF1A2, ZNFN1A2
ZNFN1A2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 43kDa
NCBI: 057344
UniProt: Q6PQC7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: REASPSNSCLDSTDSESSHDDHQSYQGHPALNPKRKQSPAYMKEDVKALD