ZNFN1A2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2142620
Article Name: ZNFN1A2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2142620
Supplier Catalog Number: orb2142620
Alternative Catalog Number: BYT-ORB2142620-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ZNFN1A2
Conjugation: Biotin
Alternative Names: ANF1A2, HELIOS, ZNF1A2, ZNFN1A2
ZNFN1A2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 43kDa
NCBI: 057344
UniProt: Q6PQC7
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: REASPSNSCLDSTDSESSHDDHQSYQGHPALNPKRKQSPAYMKEDVKALD