HDAC6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2143284
Artikelname: HDAC6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2143284
Hersteller Artikelnummer: orb2143284
Alternativnummer: BYT-ORB2143284-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ChIP, IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HDAC6
Konjugation: Biotin
Alternative Synonym: HD6, JM21, CPBHM, PPP1R90
HDAC6 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 131kDa, 17 kD
NCBI: 05872
UniProt: Q9UBN7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQ