HDAC6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2143284
| Article Name: |
HDAC6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2143284 |
| Supplier Catalog Number: |
orb2143284 |
| Alternative Catalog Number: |
BYT-ORB2143284-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
ChIP, IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human HDAC6 |
| Conjugation: |
Biotin |
| Alternative Names: |
HD6, JM21, CPBHM, PPP1R90 |
| HDAC6 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
131kDa, 17 kD |
| NCBI: |
05872 |
| UniProt: |
Q9UBN7 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: VGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQ |
