TAL1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2143378
Artikelname: TAL1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2143378
Hersteller Artikelnummer: orb2143378
Alternativnummer: BYT-ORB2143378-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TAL1
Konjugation: Biotin
Alternative Synonym: SCL, TCL5, tal-1, bHLHa17
TAL1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 34kDa
NCBI: 003180
UniProt: P17542
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: TERPPSEAARSDPQLEGRDAAEASMAPPHLVLLNGVAKETSRAAAAEPPV