TAL1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2143378
Article Name: TAL1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2143378
Supplier Catalog Number: orb2143378
Alternative Catalog Number: BYT-ORB2143378-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TAL1
Conjugation: Biotin
Alternative Names: SCL, TCL5, tal-1, bHLHa17
TAL1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 34kDa
NCBI: 003180
UniProt: P17542
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: TERPPSEAARSDPQLEGRDAAEASMAPPHLVLLNGVAKETSRAAAAEPPV