ESR1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2143944
Artikelname: ESR1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2143944
Hersteller Artikelnummer: orb2143944
Alternativnummer: BYT-ORB2143944-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human ESR1
Konjugation: Biotin
Alternative Synonym: ER, ESR, Era, ESRA, ESTRR, NR3A1
ESR1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 36kDa
NCBI: 000116
UniProt: P03372
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEG