ESR1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2143944
Article Name: ESR1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2143944
Supplier Catalog Number: orb2143944
Alternative Catalog Number: BYT-ORB2143944-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human ESR1
Conjugation: Biotin
Alternative Names: ER, ESR, Era, ESRA, ESTRR, NR3A1
ESR1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 36kDa
NCBI: 000116
UniProt: P03372
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: KASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEG