Recombinant Human Interleukin-12 receptor subunit beta-1(IL12RB1), partial (Active)

Produktübersicht

• Artikelname: Recombinant Human Interleukin-12 receptor subunit beta-1(IL12RB1), partial (Active)
• Artikelnummer: BYT-ORB2280214
• Hersteller Artikelnummer: orb2280214
• Alternativnummer: BYT-ORB2280214-20,BYT-ORB2280214-100,BYT-ORB2280214-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: IL12R, IL12RB

Produktbeschreibung

Recombinant Human Interleukin-12 receptor subunit beta-1(IL12RB1), partial (Active)

Produkteigenschaften

• Molekulargewicht: 58.5 kDa
• UniProt: P42701
• Puffer: Lyophilized powder
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 95% as determined by SDS-PAGE.
• Formulierung: Lyophilized powder
• Sequenz: CRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGT

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized human IL12RB1 at 2 µg/mL can bind Anti-IL12RB1 recombinant antibody. The EC50 is 1.578-2.143 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized human IL12RB1 at 2 µg/ml can bind Anti-IL12RB1 recombinant antibody. The EC50 is 1.578-2.143 ng/mL.

The purity of IL12RB1 was greater than 95% as determined by SEC-HPLC