Recombinant Human Interleukin-12 receptor subunit beta-1(IL12RB1), partial (Active)
Catalog Number:
BYT-ORB2280214
- Images (3)
| Article Name: | Recombinant Human Interleukin-12 receptor subunit beta-1(IL12RB1), partial (Active) |
| Biozol Catalog Number: | BYT-ORB2280214 |
| Supplier Catalog Number: | orb2280214 |
| Alternative Catalog Number: | BYT-ORB2280214-20,BYT-ORB2280214-100,BYT-ORB2280214-1 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | IL12R, IL12RB |
| Recombinant Human Interleukin-12 receptor subunit beta-1(IL12RB1), partial (Active) |
| Molecular Weight: | 58.5 kDa |
| UniProt: | P42701 |
| Buffer: | Lyophilized powder |
| Source: | Homo sapiens (Human) |
| Purity: | Greater than 95% as determined by SDS-PAGE. |
| Form: | Lyophilized powder |
| Sequence: | CRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGT |
| Application Notes: | Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized human IL12RB1 at 2 µg/mL can bind Anti-IL12RB1 recombinant antibody. The EC50 is 1.578-2.143 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference |
|
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |
|
|
Measured by its binding ability in a functional ELISA. Immobilized human IL12RB1 at 2 µg/ml can bind Anti-IL12RB1 recombinant antibody. The EC50 is 1.578-2.143 ng/mL. |
|
|
The purity of IL12RB1 was greater than 95% as determined by SEC-HPLC |
Product Guarantee and Expert Support
