Recombinant Macaca mulatta Carcinoembryonic antigen-related cell adhesion molecule 5(CEACAM5), partial (Active)

Produktübersicht

• Artikelname: Recombinant Macaca mulatta Carcinoembryonic antigen-related cell adhesion molecule 5(CEACAM5), partial (Active)
• Artikelnummer: BYT-ORB2280216
• Hersteller Artikelnummer: orb2280216
• Alternativnummer: BYT-ORB2280216-20,BYT-ORB2280216-100,BYT-ORB2280216-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide

Produktbeschreibung

Recombinant Macaca mulatta Carcinoembryonic antigen-related cell adhesion molecule 5(CEACAM5), partial (Active)

Produkteigenschaften

• Molekulargewicht: 76.9 kDa
• Puffer: Lyophilized powder
• Quelle: Macaca mulatta (Rhesus macaque)
• Reinheit: Greater than 95% as determined by SDS-PAGE.
• Formulierung: Lyophilized powder
• Sequenz: MGSPSAPLHRWCIPWQTLLLTASLLTFWNPPTTAQLTIESRPFNVAEGKEVLLLAHNVSQNLFGYIWYKGERVDASRRIGSCVIRTQQITPGPAHSGRETIDFNASLLIHNVTQSDTGSYTIQVIKEDLVNEEATGQFRVYPELPKPYISSNNSNPVEDKDAVALTCEPETQDTTYLWWVNNQSLPVSPRLELSSDNRTLTVFNIPRNDTTSYKCETQNPVSVRRSDPVTLNVLYGPDAPTISPLNTPYRAGENL

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Macaca mulatta (Rhesus macaque). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus CEACAM5 at 2µg/mL can bind Anti-CEACAM5 recombinant antibody. The EC50 is 3.572-4.044 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus CEACAM5 at 2µg/ml can bind Anti-CEACAM5 recombinant antibody. The EC50 is 3.572-4.044 ng/mL.

The purity of CEACAM5 was greater than 95% as determined by SEC-HPLC