Recombinant Macaca mulatta Carcinoembryonic antigen-related cell adhesion molecule 5(CEACAM5), partial (Active)

Product Overview

• Article Name: Recombinant Macaca mulatta Carcinoembryonic antigen-related cell adhesion molecule 5(CEACAM5), partial (Active)
• Biozol Catalog Number: BYT-ORB2280216
• Supplier Catalog Number: orb2280216
• Alternative Catalog Number: BYT-ORB2280216-20,BYT-ORB2280216-100,BYT-ORB2280216-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide

Product Description

Recombinant Macaca mulatta Carcinoembryonic antigen-related cell adhesion molecule 5(CEACAM5), partial (Active)

Product Properties

• Molecular Weight: 76.9 kDa
• Buffer: Lyophilized powder
• Source: Macaca mulatta (Rhesus macaque)
• Purity: Greater than 95% as determined by SDS-PAGE.
• Form: Lyophilized powder
• Sequence: MGSPSAPLHRWCIPWQTLLLTASLLTFWNPPTTAQLTIESRPFNVAEGKEVLLLAHNVSQNLFGYIWYKGERVDASRRIGSCVIRTQQITPGPAHSGRETIDFNASLLIHNVTQSDTGSYTIQVIKEDLVNEEATGQFRVYPELPKPYISSNNSNPVEDKDAVALTCEPETQDTTYLWWVNNQSLPVSPRLELSSDNRTLTVFNIPRNDTTSYKCETQNPVSVRRSDPVTLNVLYGPDAPTISPLNTPYRAGENL

Application Notes

• Application Notes: Biological Origin: Macaca mulatta (Rhesus macaque). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus CEACAM5 at 2µg/mL can bind Anti-CEACAM5 recombinant antibody. The EC50 is 3.572-4.044 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus CEACAM5 at 2µg/ml can bind Anti-CEACAM5 recombinant antibody. The EC50 is 3.572-4.044 ng/mL.

The purity of CEACAM5 was greater than 95% as determined by SEC-HPLC