Recombinant Human Low affinity immunoglobulin gamma Fc region receptor II-a (FCGR2A), partial

Artikelnummer: BYT-ORB2280235
Artikelname: Recombinant Human Low affinity immunoglobulin gamma Fc region receptor II-a (FCGR2A), partial
Artikelnummer: BYT-ORB2280235
Hersteller Artikelnummer: orb2280235
Alternativnummer: BYT-ORB2280235-20,BYT-ORB2280235-100,BYT-ORB2280235-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: IgG Fc receptor II-a,CDw32,Fc-gamma RII-a,Fc-gamma-RIIa,FcRII-a,CD antigen CD32
Recombinant Human Low affinity immunoglobulin gamma Fc region receptor II-a (FCGR2A), partial
Molekulargewicht: 20.4 kDa
UniProt: P12318
Puffer: Liquid or Lyophilized powder
Quelle: Homo sapiens (Human)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: QAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMG
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
The purity of FCGR2A was greater than 90% as determined by SEC-HPLC