Recombinant Human Low affinity immunoglobulin gamma Fc region receptor II-a (FCGR2A), partial

Product Overview

• Article Name: Recombinant Human Low affinity immunoglobulin gamma Fc region receptor II-a (FCGR2A), partial
• Biozol Catalog Number: BYT-ORB2280235
• Supplier Catalog Number: orb2280235
• Alternative Catalog Number: BYT-ORB2280235-20,BYT-ORB2280235-100,BYT-ORB2280235-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: IgG Fc receptor II-a,CDw32,Fc-gamma RII-a,Fc-gamma-RIIa,FcRII-a,CD antigen CD32

Product Description

Recombinant Human Low affinity immunoglobulin gamma Fc region receptor II-a (FCGR2A), partial

Product Properties

• Molecular Weight: 20.4 kDa
• UniProt: P12318
• Buffer: Liquid or Lyophilized powder
• Source: Homo sapiens (Human)
• Purity: Greater than 95% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: QAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMG

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

The purity of FCGR2A was greater than 90% as determined by SEC-HPLC