Human APOC3 protein

Artikelnummer: BYT-ORB244025
Artikelname: Human APOC3 protein
Artikelnummer: BYT-ORB244025
Hersteller Artikelnummer: orb244025
Alternativnummer: BYT-ORB244025-1,BYT-ORB244025-100,BYT-ORB244025-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: APOC3
This Human APOC3 protein spans the amino acid sequence from region 21-99aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 24.8 kDa
UniProt: P02656
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Full length of His-tag and expression region is 21-99aa. N-terminal 6xHis-SUMO-tagged
SDS-PAGE analysis of Human APOC3 protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.