Human APOC3 protein

Catalog Number: BYT-ORB244025
Article Name: Human APOC3 protein
Biozol Catalog Number: BYT-ORB244025
Supplier Catalog Number: orb244025
Alternative Catalog Number: BYT-ORB244025-1,BYT-ORB244025-100,BYT-ORB244025-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: APOC3
This Human APOC3 protein spans the amino acid sequence from region 21-99aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 24.8 kDa
UniProt: P02656
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Full length of His-tag and expression region is 21-99aa. N-terminal 6xHis-SUMO-tagged
SDS-PAGE analysis of Human APOC3 protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.