Mouse Mcpt4 protein

Artikelnummer: BYT-ORB244684
Artikelname: Mouse Mcpt4 protein
Artikelnummer: BYT-ORB244684
Hersteller Artikelnummer: orb244684
Alternativnummer: BYT-ORB244684-1,BYT-ORB244684-100,BYT-ORB244684-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Mcpt4
This Mouse Mcpt4 protein spans the amino acid sequence from region 21-246aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 29.1 kDa
UniProt: P21812
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: IIGGVESRPHSRPYMAHLEITTERGFTATCGGFLITRQFVMTAAHCSGREITVTLGAHDVSKTESTQQKIKVEKQIVHPKYNFYSNLHDIMLLKLQKKAKETPSVNVIPLPRPSDFIKPGKMCRAAGWGRTGVTEPTSDTLREVKLRIMDKEACKNYWHYDYNLQVCVGSPRKKRSAYKGDSGGPLLCAGVAHGIVSYGRGDAKPPAVFTRISSYVPWINRVIKGE
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: Full length of His-tag and expression region is 21-246aa
SDS-PAGE analysis of Mouse Mcpt4 protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.