Mouse Mcpt4 protein

Catalog Number: BYT-ORB244684
Article Name: Mouse Mcpt4 protein
Biozol Catalog Number: BYT-ORB244684
Supplier Catalog Number: orb244684
Alternative Catalog Number: BYT-ORB244684-1,BYT-ORB244684-100,BYT-ORB244684-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Mcpt4
This Mouse Mcpt4 protein spans the amino acid sequence from region 21-246aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 29.1 kDa
UniProt: P21812
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: IIGGVESRPHSRPYMAHLEITTERGFTATCGGFLITRQFVMTAAHCSGREITVTLGAHDVSKTESTQQKIKVEKQIVHPKYNFYSNLHDIMLLKLQKKAKETPSVNVIPLPRPSDFIKPGKMCRAAGWGRTGVTEPTSDTLREVKLRIMDKEACKNYWHYDYNLQVCVGSPRKKRSAYKGDSGGPLLCAGVAHGIVSYGRGDAKPPAVFTRISSYVPWINRVIKGE
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: Full length of His-tag and expression region is 21-246aa
SDS-PAGE analysis of Mouse Mcpt4 protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.