Recombinant Salmonella typhimurium Outer membrane porin protein OmpD (ompD)

Produktübersicht

• Artikelname: Recombinant Salmonella typhimurium Outer membrane porin protein OmpD (ompD)
• Artikelnummer: BYT-ORB244694
• Hersteller Artikelnummer: orb244694
• Alternativnummer: BYT-ORB244694-20,BYT-ORB244694-100,BYT-ORB244694-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: ompD

Produktbeschreibung

This Recombinant Salmonella typhimurium Outer membrane porin protein OmpD (ompD) spans the amino acid sequence from region 22-362aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 53.6 kDa
• UniProt: P37592
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: AEVYNKDGNKLDLYGKVHAQHYFSDDNGSDGDKTYARLGFKGETQINDQLTGFGQWEYEFKGNRTESQGADKDKTRLAFAGLKFADYGSFDYGRNYGVAYDIGAWTDVLPEFGGDTWTQTDVFMTGRTTGVATYRNTDFFGLVEGLNFAAQYQGKNDRDGAYESNGDGFGLSATYEYEGFGVGAAYAKSDRTNNQVKAASNLNAAGKNAEVWAAGLKYDANNIYLATTYSETLNMTTFGEDAAGDAFIANKTQNF

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720). Application Notes: This is His-SUMO-tag protein

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) ompD.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) ompD.