Recombinant Salmonella typhimurium Outer membrane porin protein OmpD (ompD)

Product Overview

• Article Name: Recombinant Salmonella typhimurium Outer membrane porin protein OmpD (ompD)
• Biozol Catalog Number: BYT-ORB244694
• Supplier Catalog Number: orb244694
• Alternative Catalog Number: BYT-ORB244694-20,BYT-ORB244694-100,BYT-ORB244694-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: ompD

Product Description

This Recombinant Salmonella typhimurium Outer membrane porin protein OmpD (ompD) spans the amino acid sequence from region 22-362aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 53.6 kDa
• UniProt: P37592
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: AEVYNKDGNKLDLYGKVHAQHYFSDDNGSDGDKTYARLGFKGETQINDQLTGFGQWEYEFKGNRTESQGADKDKTRLAFAGLKFADYGSFDYGRNYGVAYDIGAWTDVLPEFGGDTWTQTDVFMTGRTTGVATYRNTDFFGLVEGLNFAAQYQGKNDRDGAYESNGDGFGLSATYEYEGFGVGAAYAKSDRTNNQVKAASNLNAAGKNAEVWAAGLKYDANNIYLATTYSETLNMTTFGEDAAGDAFIANKTQNF

Application Notes

• Application Notes: Biological Origin: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720). Application Notes: This is His-SUMO-tag protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) ompD.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) ompD.