E.coli prgI protein
Artikelnummer:
BYT-ORB244699
- Bilder (3)
| Artikelname: | E.coli prgI protein |
| Artikelnummer: | BYT-ORB244699 |
| Hersteller Artikelnummer: | orb244699 |
| Alternativnummer: | BYT-ORB244699-20,BYT-ORB244699-100,BYT-ORB244699-1 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | prgI |
| This E.coli prgI protein spans the amino acid sequence from region 1-80aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molekulargewicht: | 24.9 kDa |
| UniProt: | P41784 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | MATPWSGYLDDVSAKFDTGVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYRNAQSNTVKVFKDIDAAIIQNFR |
| Anwendungsbeschreibung: | Biological Origin: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720). Application Notes: This is His-SUMO-tag protein |



