E.coli prgI protein

Catalog Number: BYT-ORB244699
Article Name: E.coli prgI protein
Biozol Catalog Number: BYT-ORB244699
Supplier Catalog Number: orb244699
Alternative Catalog Number: BYT-ORB244699-20,BYT-ORB244699-100,BYT-ORB244699-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: prgI
This E.coli prgI protein spans the amino acid sequence from region 1-80aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 24.9 kDa
UniProt: P41784
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MATPWSGYLDDVSAKFDTGVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYRNAQSNTVKVFKDIDAAIIQNFR
Application Notes: Biological Origin: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) prgI.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) prgI.