E.coli prgI protein
Catalog Number:
BYT-ORB244699
- Images (3)
| Article Name: | E.coli prgI protein |
| Biozol Catalog Number: | BYT-ORB244699 |
| Supplier Catalog Number: | orb244699 |
| Alternative Catalog Number: | BYT-ORB244699-20,BYT-ORB244699-100,BYT-ORB244699-1 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | prgI |
| This E.coli prgI protein spans the amino acid sequence from region 1-80aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 24.9 kDa |
| UniProt: | P41784 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MATPWSGYLDDVSAKFDTGVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYRNAQSNTVKVFKDIDAAIIQNFR |
| Application Notes: | Biological Origin: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720). Application Notes: This is His-SUMO-tag protein |



