E.coli mpt51 protein

Artikelnummer: BYT-ORB244758
Artikelname: E.coli mpt51 protein
Artikelnummer: BYT-ORB244758
Hersteller Artikelnummer: orb244758
Alternativnummer: BYT-ORB244758-20,BYT-ORB244758-100,BYT-ORB244758-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: mpt51
This E.coli mpt51 protein spans the amino acid sequence from region 27-299aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 44.5 kDa
UniProt: P9WQN6
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: AEPTAKAAPYENLMVPSPSMGRDIPVAFLAGGPHAVYLLDAFNAGPDVSNWVTAGNAMNTLAGKGISVVAPAGGAYSMYTNWEQDGSKQWDTFLSAELPDWLAANRGLAPGGHAAVGAAQGGYGAMALAAFHPDRFGFAGSMSGFLYPSNTTTNGAIAAGMQQFGGVDTNGMWGAPQLGRWKWHDPWVHASLLAQNNTRVWVWSPTNPGASDPAAMIGQAAEAMGNSRMFYNQYRSVGGHNGHFDFPASGDNGWG
Anwendungsbeschreibung: Biological Origin: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mycobacterium tuberculosismpt51.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mycobacterium tuberculosismpt51.