E.coli mpt51 protein

Product Overview

• Article Name: E.coli mpt51 protein
• Biozol Catalog Number: BYT-ORB244758
• Supplier Catalog Number: orb244758
• Alternative Catalog Number: BYT-ORB244758-1,BYT-ORB244758-100,BYT-ORB244758-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: mpt51

Product Description

This E.coli mpt51 protein spans the amino acid sequence from region 27-299aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 44.5 kDa
• UniProt: P9WQN6
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: AEPTAKAAPYENLMVPSPSMGRDIPVAFLAGGPHAVYLLDAFNAGPDVSNWVTAGNAMNTLAGKGISVVAPAGGAYSMYTNWEQDGSKQWDTFLSAELPDWLAANRGLAPGGHAAVGAAQGGYGAMALAAFHPDRFGFAGSMSGFLYPSNTTTNGAIAAGMQQFGGVDTNGMWGAPQLGRWKWHDPWVHASLLAQNNTRVWVWSPTNPGASDPAAMIGQAAEAMGNSRMFYNQYRSVGGHNGHFDFPASGDNGWG

Application Notes

• Application Notes: Biological Origin: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh). Application Notes: This is His-SUMO-tag protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mycobacterium tuberculosismpt51.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mycobacterium tuberculosismpt51.