E. coli lldD protein

Artikelnummer: BYT-ORB244774
Artikelname: E. coli lldD protein
Artikelnummer: BYT-ORB244774
Hersteller Artikelnummer: orb244774
Alternativnummer: BYT-ORB244774-1,BYT-ORB244774-100,BYT-ORB244774-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: lldD
This E. coli lldD protein spans the amino acid sequence from region 1-396aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 46.7 kDa
UniProt: A8A670
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Escherichia coli O9:H4 (strain HS)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MIISAASDYRAAAQRILPPFLFHYMDGGAYSEYTLRRNVEDLSEVALRQRILKNMSDLSLETTLFNEKLSMPVALAPVGLCGMYARRGEVQAAKAADAHGIPFTLSTVSVCPIEEVAPAIKRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPTPGARYRDAHSGMSGPNAAMRRYLQAVTHPQWAWDVGLNGRPHDLGNISAYLGKPTGLEDYIGWLGNNFDPSISWKDLEWIRDFWDGPMVIKGILD
Anwendungsbeschreibung: Biological Origin: Escherichia coli O9:H4 (strain HS). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli O9: H4 (strain HS) lldD.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli O9: H4 (strain HS) lldD.