E. coli lldD protein

Catalog Number: BYT-ORB244774
Article Name: E. coli lldD protein
Biozol Catalog Number: BYT-ORB244774
Supplier Catalog Number: orb244774
Alternative Catalog Number: BYT-ORB244774-1,BYT-ORB244774-100,BYT-ORB244774-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: lldD
This E. coli lldD protein spans the amino acid sequence from region 1-396aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 46.7 kDa
UniProt: A8A670
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Escherichia coli O9:H4 (strain HS)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MIISAASDYRAAAQRILPPFLFHYMDGGAYSEYTLRRNVEDLSEVALRQRILKNMSDLSLETTLFNEKLSMPVALAPVGLCGMYARRGEVQAAKAADAHGIPFTLSTVSVCPIEEVAPAIKRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPTPGARYRDAHSGMSGPNAAMRRYLQAVTHPQWAWDVGLNGRPHDLGNISAYLGKPTGLEDYIGWLGNNFDPSISWKDLEWIRDFWDGPMVIKGILD
Application Notes: Biological Origin: Escherichia coli O9:H4 (strain HS). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli O9: H4 (strain HS) lldD.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli O9: H4 (strain HS) lldD.