E.coli thiO protein

Produktübersicht

• Artikelname: E.coli thiO protein
• Artikelnummer: BYT-ORB244782
• Hersteller Artikelnummer: orb244782
• Alternativnummer: BYT-ORB244782-1,BYT-ORB244782-100,BYT-ORB244782-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: thiO

Produktbeschreibung

This E.coli thiO protein spans the amino acid sequence from region 1-369aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 56.9 kDa
• UniProt: O31616
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Bacillus subtilis (strain 168)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MKRHYEAVVIGGGIIGSAIAYYLAKENKNTALFESGTMGGRTTSAAAGMLGAHAECEERDAFFDFAMHSQRLYKGLGEELYALSGVDIRQHNGGMFKLAFSEEDVLQLRQMDDLDSVSWYSKEEVLEKEPYASGDIFGASFIQDDVHVEPYFVCKAYVKAAKMLGAEIFEHTPVLHVERDGEALFIKTPSGDVWANHVVVASGVWSGMFFKQLGLNNAFLPVKGECLSVWNDDIPLTKTLYHDHCYIVPRKSGRL

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Bacillus subtilis (strain 168). Application Notes: This is His-SUMO-tag protein

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Bacillus subtilis (strain 168) thiO.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Bacillus subtilis (strain 168) thiO.