E.coli thiO protein

Catalog Number: BYT-ORB244782
Article Name: E.coli thiO protein
Biozol Catalog Number: BYT-ORB244782
Supplier Catalog Number: orb244782
Alternative Catalog Number: BYT-ORB244782-1,BYT-ORB244782-100,BYT-ORB244782-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: thiO
This E.coli thiO protein spans the amino acid sequence from region 1-369aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 56.9 kDa
UniProt: O31616
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Bacillus subtilis (strain 168)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MKRHYEAVVIGGGIIGSAIAYYLAKENKNTALFESGTMGGRTTSAAAGMLGAHAECEERDAFFDFAMHSQRLYKGLGEELYALSGVDIRQHNGGMFKLAFSEEDVLQLRQMDDLDSVSWYSKEEVLEKEPYASGDIFGASFIQDDVHVEPYFVCKAYVKAAKMLGAEIFEHTPVLHVERDGEALFIKTPSGDVWANHVVVASGVWSGMFFKQLGLNNAFLPVKGECLSVWNDDIPLTKTLYHDHCYIVPRKSGRL
Application Notes: Biological Origin: Bacillus subtilis (strain 168). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Bacillus subtilis (strain 168) thiO.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Bacillus subtilis (strain 168) thiO.